PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016893
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 593aa    MW: 67524.4 Da    PI: 4.8976
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016893genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS282.21.5e-862165831374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.....fsevsPilkf 93 
                  lve Ll++Ae v ++++e+a++lL++ + ++sp+gd++qRl++yft+AL++r+ r      k+ + s++++  s++e+++        f+e  P+ ++
  Lus10016893 216 LVEFLLTAAEKVGDEQFERARNLLTECELQSSPSGDSVQRLVHYFTRALRERIDR------KTGKGSDEKSAASIHEIFMPPKecfleFYEKVPFGQV 307
                  5789***************************************************......444444444444444444432224467********** PP

         GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                  s ++a qa++++v++++r+Hi+Df+i++G QW+ ++qaL sR+ ++  +l+iT++g      ++ leetg+ L+ fAe++ ++f+f++++++ + dle
  Lus10016893 308 SEFAAIQAVVDSVANATRIHIVDFNIKNGEQWIIFMQALVSREaNPVDRLKITAIGT---MGRDLLEETGKWLTGFAETMALSFSFKLIMVEGFMDLE 402
                  *******************************************55556*********...689*********************************** PP

         GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                   ++++v+++E++a+   + l +l     s+e+  d v++++++l+P v+vv+e e++ ns+ F++rf+e+l y sa+fd+le+ + r+s +r++ E +
  Lus10016893 403 QDMFEVDRDETVAILAEYILTTLI---SSIEK-LDYVMNVMRHLNPCVMVVTEVESNQNSPVFVNRFIETLFYTSAFFDCLEVCMDRDSPHRMFAESR 496
                  ******************999999...55555.888************************************************************** PP

         GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++g+ ++ vva+eg+er+ r  ++e+Wr  ++++ ++++ ls +   qa+l+ +k++ ++  +v  + +sl+  Wk+ p+ sv+aW+
  Lus10016893 497 FFGEGAKIVVAAEGEERVIRSVKMETWRGYFGRSRMEEADLSFSCLYQAELVSKKFPsWRFCSVGRDGKSLIVRWKGTPIHSVTAWK 583
                  *********************************************************6666788899999****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.412190562IPR005202Transcription factor GRAS
PfamPF035145.1E-84216583IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MADQIFSFQF NHAGIQDQLP NHQNFHSDPF SLFEGWISPQ ASSDHHQHDL QYFPFLSYEY  60
NEPIHHENHH ISVPISELDE MIRRQVGVND KPQALSELDE LIYSTQVPVN EKSIPKNPRI  120
STCGLSSPLF DLLRGPTNGS RKRLNNNDAG TRVCKTINND TVDAVDSVRL MSTEELVRIA  180
GARFIQSSYK SGDLVSKPCD FSFSGLSDDE FRNVELVEFL LTAAEKVGDE QFERARNLLT  240
ECELQSSPSG DSVQRLVHYF TRALRERIDR KTGKGSDEKS AASIHEIFMP PKECFLEFYE  300
KVPFGQVSEF AAIQAVVDSV ANATRIHIVD FNIKNGEQWI IFMQALVSRE ANPVDRLKIT  360
AIGTMGRDLL EETGKWLTGF AETMALSFSF KLIMVEGFMD LEQDMFEVDR DETVAILAEY  420
ILTTLISSIE KLDYVMNVMR HLNPCVMVVT EVESNQNSPV FVNRFIETLF YTSAFFDCLE  480
VCMDRDSPHR MFAESRFFGE GAKIVVAAEG EERVIRSVKM ETWRGYFGRS RMEEADLSFS  540
CLYQAELVSK KFPSWRFCSV GRDGKSLIVR WKGTPIHSVT AWKFNTESEV YV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3623958326375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM5XKD71e-159M5XKD7_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15350.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.17e-49RGA-like 2